PRPSAP1 monoclonal antibody (M01), clone 5H10 View larger

PRPSAP1 monoclonal antibody (M01), clone 5H10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRPSAP1 monoclonal antibody (M01), clone 5H10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PRPSAP1 monoclonal antibody (M01), clone 5H10

Brand: Abnova
Reference: H00005635-M01
Product name: PRPSAP1 monoclonal antibody (M01), clone 5H10
Product description: Mouse monoclonal antibody raised against a partial recombinant PRPSAP1.
Clone: 5H10
Isotype: IgG1 Kappa
Gene id: 5635
Gene name: PRPSAP1
Gene alias: PAP39
Gene description: phosphoribosyl pyrophosphate synthetase-associated protein 1
Genbank accession: BC009012
Immunogen: PRPSAP1 (AAH09012.1, 175 a.a. ~ 266 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AKSPDAAKRAQSYAERLRLGLAVIHGEAQCTELDMDDGRHSPPMVKNATVHPGLELPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFV
Protein accession: AAH09012.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005635-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005635-M01-13-15-1.jpg
Application image note: Western Blot analysis of PRPSAP1 expression in transfected 293T cell line by PRPSAP1 monoclonal antibody (M01), clone 5H10.

Lane 1: PRPSAP1 transfected lysate (Predicted MW: 39.4 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRPSAP1 monoclonal antibody (M01), clone 5H10 now

Add to cart