Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00005634-M02 |
Product name: | PRPS2 monoclonal antibody (M02), clone 4C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRPS2. |
Clone: | 4C1 |
Isotype: | IgG2a Kappa |
Gene id: | 5634 |
Gene name: | PRPS2 |
Gene alias: | PRSII |
Gene description: | phosphoribosyl pyrophosphate synthetase 2 |
Genbank accession: | NM_002765 |
Immunogen: | PRPS2 (NP_002756, 160 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAV |
Protein accession: | NP_002756 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PRPS2 expression in transfected 293T cell line by PRPS2 monoclonal antibody (M02), clone 4C1. Lane 1: PRPS2 transfected lysate(34.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |