PRPS1 polyclonal antibody (A01) View larger

PRPS1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRPS1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about PRPS1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00005631-A01
Product name: PRPS1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PRPS1.
Gene id: 5631
Gene name: PRPS1
Gene alias: ARTS|CMTX5|KIAA0967|PPRibP|PRSI
Gene description: phosphoribosyl pyrophosphate synthetase 1
Genbank accession: NM_002764
Immunogen: PRPS1 (NP_002755, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MPNIKIFSGSSHQDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKK
Protein accession: NP_002755
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005631-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005631-A01-13-15-1.jpg
Application image note: Western Blot analysis of PRPS1 expression in transfected 293T cell line by PRPS1 polyclonal antibody (A01).

Lane1:PRPS1 transfected lysate(34.8 KDa).
Lane2:Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRPS1 polyclonal antibody (A01) now

Add to cart