Brand: | Abnova |
Reference: | H00005630-M02 |
Product name: | PRPH monoclonal antibody (M02), clone 3B3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRPH. |
Clone: | 3B3 |
Isotype: | IgG2b Kappa |
Gene id: | 5630 |
Gene name: | PRPH |
Gene alias: | NEF4|PRPH1 |
Gene description: | peripherin |
Genbank accession: | NM_006262 |
Immunogen: | PRPH (NP_006253, 374 a.a. ~ 470 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLNIKTTVPEVEPPQDSHSRKTVLIKTIETRNGEVVTESQKEQRSELDKSSAHSY |
Protein accession: | NP_006253 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PRPH monoclonal antibody (M02), clone 3B3. Western Blot analysis of PRPH expression in IMR-32(Cat # L008V1 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |