Brand: | Abnova |
Reference: | H00005629-M09 |
Product name: | PROX1 monoclonal antibody (M09), clone 1H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PROX1. |
Clone: | 1H6 |
Isotype: | IgG2a Kappa |
Gene id: | 5629 |
Gene name: | PROX1 |
Gene alias: | - |
Gene description: | prospero homeobox 1 |
Genbank accession: | NM_002763 |
Immunogen: | PROX1 (NP_002754.2, 638 a.a. ~ 737 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE |
Protein accession: | NP_002754.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005629-M09-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005629-M09-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005629-M09-2-B4-1.jpg](http://www.abnova.com/application_image/H00005629-M09-2-B4-1.jpg) |
Application image note: | PROX1 monoclonal antibody (M09), clone 1H6. Western Blot analysis of PROX1 expression in human skeletal muscle. |
Applications: | WB-Ce,WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |