Brand: | Abnova |
Reference: | H00005624-M01 |
Product name: | PROC monoclonal antibody (M01), clone 3A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PROC. |
Clone: | 3A10 |
Isotype: | IgG1 Kappa |
Gene id: | 5624 |
Gene name: | PROC |
Gene alias: | PC|PROC1 |
Gene description: | protein C (inactivator of coagulation factors Va and VIIIa) |
Genbank accession: | BC034377 |
Immunogen: | PROC (AAH34377, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RAHQVLRIRKRANSFLEELRHSSLERECIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSCDCRSGWEGRFC |
Protein accession: | AAH34377 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PROC monoclonal antibody (M01), clone 3A10. Western Blot analysis of PROC expression in human liver. |
Applications: | WB-Ti,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |