PRM2 (Human) Recombinant Protein (P01) View larger

PRM2 (Human) Recombinant Protein (P01)

New product

438,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRM2 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about PRM2 (Human) Recombinant Protein (P01)

Product description: Human PRM2 full-length ORF ( NP_002753.2, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 5620
Gene name: PRM2
Gene alias: FLJ27447
Gene description: protamine 2
Genbank accession: NM_002762.2
Immunogen sequence/protein sequence: MVRYRVRSLSERSHEVYRQQLHGQEQGHHGQEEQGLSPEHVEVYERTHGQSHYRRRHCSRRRLHRIHRRQHRSCRRRKRRSCRHRRRHRRGCRTRKRTCRRH
Protein accession: NP_002753.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Size: 25 ug
Shipping condition: Dry Ice

Reviews

Buy PRM2 (Human) Recombinant Protein (P01) now

Add to cart