Brand: | Abnova |
Reference: | H00005617-M06 |
Product name: | PRL monoclonal antibody (M06), clone X1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PRL. |
Clone: | X1 |
Isotype: | IgG2a Kappa |
Gene id: | 5617 |
Gene name: | PRL |
Gene alias: | - |
Gene description: | prolactin |
Genbank accession: | BC015850 |
Immunogen: | PRL (AAH15850, 29 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC |
Protein accession: | AAH15850 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (47.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged PRL is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |