PRKRIR purified MaxPab mouse polyclonal antibody (B01P) View larger

PRKRIR purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKRIR purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about PRKRIR purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005612-B01P
Product name: PRKRIR purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PRKRIR protein.
Gene id: 5612
Gene name: PRKRIR
Gene alias: DAP4|MGC102750|P52rIPK
Gene description: protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor)
Genbank accession: BC021992
Immunogen: PRKRIR (AAH21992.1, 1 a.a. ~ 150 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Protein accession: AAH21992.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005612-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PRKRIR expression in transfected 293T cell line (H00005612-T01) by PRKRIR MaxPab polyclonal antibody.

Lane 1: PRKRIR transfected lysate(16.5 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRKRIR purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart