PRKRIR MaxPab mouse polyclonal antibody (B01) View larger

PRKRIR MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKRIR MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about PRKRIR MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00005612-B01
Product name: PRKRIR MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PRKRIR protein.
Gene id: 5612
Gene name: PRKRIR
Gene alias: DAP4|MGC102750|P52rIPK
Gene description: protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor)
Genbank accession: BC021992
Immunogen: PRKRIR (AAH21992, 1 a.a. ~ 150 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Protein accession: AAH21992
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005612-B01-13-15-1.jpg
Application image note: Western Blot analysis of PRKRIR expression in transfected 293T cell line (H00005612-T01) by PRKRIR MaxPab polyclonal antibody.

Lane 1: PRKRIR transfected lysate(16.5 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRKRIR MaxPab mouse polyclonal antibody (B01) now

Add to cart