Brand: | Abnova |
Reference: | H00005611-M03 |
Product name: | DNAJC3 monoclonal antibody (M03), clone S2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant DNAJC3. |
Clone: | S2 |
Isotype: | IgG2a Kappa |
Gene id: | 5611 |
Gene name: | DNAJC3 |
Gene alias: | HP58|P58|P58IPK|PRKRI |
Gene description: | DnaJ (Hsp40) homolog, subfamily C, member 3 |
Genbank accession: | BC033823 |
Immunogen: | DNAJC3 (AAH33823, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS |
Protein accession: | AAH33823 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (51.48 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged DNAJC3 is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |