DNAJC3 monoclonal antibody (M03), clone S2 View larger

DNAJC3 monoclonal antibody (M03), clone S2

H00005611-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAJC3 monoclonal antibody (M03), clone S2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about DNAJC3 monoclonal antibody (M03), clone S2

Brand: Abnova
Reference: H00005611-M03
Product name: DNAJC3 monoclonal antibody (M03), clone S2
Product description: Mouse monoclonal antibody raised against a full-length recombinant DNAJC3.
Clone: S2
Isotype: IgG2a Kappa
Gene id: 5611
Gene name: DNAJC3
Gene alias: HP58|P58|P58IPK|PRKRI
Gene description: DnaJ (Hsp40) homolog, subfamily C, member 3
Genbank accession: BC033823
Immunogen: DNAJC3 (AAH33823, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS
Protein accession: AAH33823
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005611-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (51.48 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005611-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DNAJC3 is 0.3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DNAJC3 monoclonal antibody (M03), clone S2 now

Add to cart