Brand: | Abnova |
Reference: | H00005611-M01 |
Product name: | DNAJC3 monoclonal antibody (M01), clone 4D3-F2 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant DNAJC3. |
Clone: | 4D3-F2 |
Isotype: | IgG2a kappa |
Gene id: | 5611 |
Gene name: | DNAJC3 |
Gene alias: | HP58|P58|P58IPK|PRKRI |
Gene description: | DnaJ (Hsp40) homolog, subfamily C, member 3 |
Genbank accession: | BC033823 |
Immunogen: | DNAJC3 (AAH33823, 1 a.a. ~ 234 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVAPGSVTSRLGSVFPFLLVLVDLQYEGAECGVNADVEKHLELGKKLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFTAARLQRGHLLLKQGKLDEAEDDFKKVVFPVPSLLGLQRSLLDDLYLLFWFFLMKKVTFRCLSSAISECLPQSLNLMKFNLLISFLLLWTVRLVSCLRSIHYAVGSKTFLISSKSFMVLCFIFKPIVYLS |
Protein accession: | AAH33823 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (51.48 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to DNAJC3 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | p58(IPK) is an Inhibitor of the eIF2α Kinase GCN2 and its Localisation and Expression Underpin Protein Synthesis and ER Processing Capacity.Roobol A, Roobol J, Bastide A, Knight JR, Willis AE, Smales CM Biochem J. 2014 Oct 20. |