Brand: | Abnova |
Reference: | H00005610-M03 |
Product name: | EIF2AK2 monoclonal antibody (M03), clone 2C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF2AK2. |
Clone: | 2C2 |
Isotype: | IgG |
Gene id: | 5610 |
Gene name: | EIF2AK2 |
Gene alias: | EIF2AK1|MGC126524|PKR|PRKR |
Gene description: | eukaryotic translation initiation factor 2-alpha kinase 2 |
Genbank accession: | NM_002759 |
Immunogen: | EIF2AK2 (NP_002750, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGN |
Protein accession: | NP_002750 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005610-M03-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005610-M03-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005610-M03-4-1-1-L.jpg](http://www.abnova.com/application_image/H00005610-M03-4-1-1-L.jpg) |
Application image note: | Immunofluorescence of monoclonal antibody to EIF2AK2 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |