Brand: | Abnova |
Reference: | H00005607-M06 |
Product name: | MAP2K5 monoclonal antibody (M06), clone 1F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP2K5. |
Clone: | 1F6 |
Isotype: | IgG1 Kappa |
Gene id: | 5607 |
Gene name: | MAP2K5 |
Gene alias: | HsT17454|MAPKK5|MEK5|PRKMK5 |
Gene description: | mitogen-activated protein kinase kinase 5 |
Genbank accession: | BC008838 |
Immunogen: | MAP2K5 (AAH08838, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL |
Protein accession: | AAH08838 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged MAP2K5 is approximately 10ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |