Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAP2K2 polyclonal antibody (A02)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about MAP2K2 polyclonal antibody (A02)
| Brand: | Abnova |
| Reference: | H00005605-A02 |
| Product name: | MAP2K2 polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MAP2K2. |
| Gene id: | 5605 |
| Gene name: | MAP2K2 |
| Gene alias: | FLJ26075|MAPKK2|MEK2|MKK2|PRKMK2 |
| Gene description: | mitogen-activated protein kinase kinase 2 |
| Genbank accession: | BC000471 |
| Immunogen: | MAP2K2 (AAH00471, 291 a.a. ~ 400 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PHSISPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCLIKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAV |
| Protein accession: | AAH00471 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MAP2K2 polyclonal antibody (A02), Lot # 060428JCS1 Western Blot analysis of MAP2K2 expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |