MAP2K1 monoclonal antibody (M01), clone 1B5 View larger

MAP2K1 monoclonal antibody (M01), clone 1B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP2K1 monoclonal antibody (M01), clone 1B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about MAP2K1 monoclonal antibody (M01), clone 1B5

Brand: Abnova
Reference: H00005604-M01
Product name: MAP2K1 monoclonal antibody (M01), clone 1B5
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP2K1.
Clone: 1B5
Isotype: IgG1 kappa
Gene id: 5604
Gene name: MAP2K1
Gene alias: MAPKK1|MEK1|MKK1|PRKMK1
Gene description: mitogen-activated protein kinase kinase 1
Genbank accession: NM_002755
Immunogen: MAP2K1 (NP_002746, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
Protein accession: NP_002746
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005604-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005604-M01-13-15-1.jpg
Application image note: Western Blot analysis of MAP2K1 expression in transfected 293T cell line by MAP2K1 monoclonal antibody (M01), clone 1B5.

Lane 1: MAP2K1 transfected lysate (Predicted MW: 43.439 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MAP2K1 monoclonal antibody (M01), clone 1B5 now

Add to cart