Brand: | Abnova |
Reference: | H00005603-M13 |
Product name: | MAPK13 monoclonal antibody (M13), clone 3H7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MAPK13. |
Clone: | 3H7 |
Isotype: | IgG2a Kappa |
Gene id: | 5603 |
Gene name: | MAPK13 |
Gene alias: | MGC99536|PRKM13|SAPK4|p38delta |
Gene description: | mitogen-activated protein kinase 13 |
Genbank accession: | BC000433 |
Immunogen: | MAPK13 (AAH00433, 1 a.a. ~ 365 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL |
Protein accession: | AAH00433 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (65.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MAPK13 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |