No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005603-M03A |
Product name: | MAPK13 monoclonal antibody (M03A), clone 1E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK13. |
Clone: | 1E11 |
Isotype: | IgG1 Kappa |
Gene id: | 5603 |
Gene name: | MAPK13 |
Gene alias: | MGC99536|PRKM13|SAPK4|p38delta |
Gene description: | mitogen-activated protein kinase 13 |
Genbank accession: | BC000433 |
Immunogen: | MAPK13 (AAH00433, 251 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL |
Protein accession: | AAH00433 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | MAPK13 monoclonal antibody (M03A), clone 1E11 Western Blot analysis of MAPK13 expression in A-549 ( Cat # L025V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |