Brand: | Abnova |
Reference: | H00005603-M02 |
Product name: | MAPK13 monoclonal antibody (M02), clone 2D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK13. |
Clone: | 2D8 |
Isotype: | IgG2b Kappa |
Gene id: | 5603 |
Gene name: | MAPK13 |
Gene alias: | MGC99536|PRKM13|SAPK4|p38delta |
Gene description: | mitogen-activated protein kinase 13 |
Genbank accession: | BC000433 |
Immunogen: | MAPK13 (AAH00433, 251 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL |
Protein accession: | AAH00433 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to MAPK13 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |