MAPK10 monoclonal antibody (M06), clone 2B2 View larger

MAPK10 monoclonal antibody (M06), clone 2B2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPK10 monoclonal antibody (M06), clone 2B2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MAPK10 monoclonal antibody (M06), clone 2B2

Brand: Abnova
Reference: H00005602-M06
Product name: MAPK10 monoclonal antibody (M06), clone 2B2
Product description: Mouse monoclonal antibody raised against a partial recombinant MAPK10.
Clone: 2B2
Isotype: IgG1 Kappa
Gene id: 5602
Gene name: MAPK10
Gene alias: FLJ12099|FLJ33785|JNK3|JNK3A|MGC50974|PRKM10|p493F12|p54bSAPK
Gene description: mitogen-activated protein kinase 10
Genbank accession: BC065516
Immunogen: MAPK10 (AAH65516, 219 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
Protein accession: AAH65516
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005602-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAPK10 monoclonal antibody (M06), clone 2B2 now

Add to cart