Brand: | Abnova |
Reference: | H00005602-M05 |
Product name: | MAPK10 monoclonal antibody (M05), clone 3B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK10. |
Clone: | 3B9 |
Isotype: | IgG1 Kappa |
Gene id: | 5602 |
Gene name: | MAPK10 |
Gene alias: | FLJ12099|FLJ33785|JNK3|JNK3A|MGC50974|PRKM10|p493F12|p54bSAPK |
Gene description: | mitogen-activated protein kinase 10 |
Genbank accession: | BC065516 |
Immunogen: | MAPK10 (AAH65516, 219 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAAVNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR |
Protein accession: | AAH65516 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005602-M05-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005602-M05-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005602-M05-1-1-1.jpg](http://www.abnova.com/application_image/H00005602-M05-1-1-1.jpg) |
Application image note: | MAPK10 monoclonal antibody (M05), clone 3B9 Western Blot analysis of MAPK10 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |