Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAPK9 monoclonal antibody (M05), clone 1D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,IF,ELISA,WB-Re |
More info about MAPK9 monoclonal antibody (M05), clone 1D6
| Brand: | Abnova |
| Reference: | H00005601-M05 |
| Product name: | MAPK9 monoclonal antibody (M05), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK9. |
| Clone: | 1D6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5601 |
| Gene name: | MAPK9 |
| Gene alias: | JNK-55|JNK2|JNK2A|JNK2ALPHA|JNK2B|JNK2BETA|PRKM9|SAPK|p54a|p54aSAPK |
| Gene description: | mitogen-activated protein kinase 9 |
| Genbank accession: | BC032539 |
| Immunogen: | MAPK9 (AAH32539, 321 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLEGCR |
| Protein accession: | AAH32539 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | MAPK9 monoclonal antibody (M05), clone 1D6. Western Blot analysis of MAPK9 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,WB-Ti,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |