MAPK11 monoclonal antibody (M03), clone 1F9 View larger

MAPK11 monoclonal antibody (M03), clone 1F9

H00005600-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPK11 monoclonal antibody (M03), clone 1F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about MAPK11 monoclonal antibody (M03), clone 1F9

Brand: Abnova
Reference: H00005600-M03
Product name: MAPK11 monoclonal antibody (M03), clone 1F9
Product description: Mouse monoclonal antibody raised against a partial recombinant MAPK11.
Clone: 1F9
Isotype: IgG2a Kappa
Gene id: 5600
Gene name: MAPK11
Gene alias: P38B|P38BETA2|PRKM11|SAPK2|SAPK2B|p38-2|p38Beta
Gene description: mitogen-activated protein kinase 11
Genbank accession: BC027933
Immunogen: MAPK11 (AAH27933, 255 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Protein accession: AAH27933
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005600-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005600-M03-42-R01V-1.jpg
Application image note: Western blot analysis of MAPK11 over-expressed 293 cell line, cotransfected with MAPK11 Validated Chimera RNAi ( Cat # H00005600-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MAPK11 monoclonal antibody (M03) clone 1F9 (Cat # H00005600-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy MAPK11 monoclonal antibody (M03), clone 1F9 now

Add to cart