Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr,IP |
Brand: | Abnova |
Reference: | H00005600-D01 |
Product name: | MAPK11 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human MAPK11 protein. |
Gene id: | 5600 |
Gene name: | MAPK11 |
Gene alias: | P38B|P38BETA2|PRKM11|SAPK2|SAPK2B|p38-2|p38Beta |
Gene description: | mitogen-activated protein kinase 11 |
Genbank accession: | NM_002751.5 |
Immunogen: | MAPK11 (NP_002742.3, 1 a.a. ~ 364 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ |
Protein accession: | NP_002742.3 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MAPK11 expression in transfected 293T cell line (H00005600-T02) by MAPK11 MaxPab polyclonal antibody. Lane 1: MAPK11 transfected lysate(41.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |