Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00005599-M10 |
Product name: | MAPK8 monoclonal antibody (M10), clone 3F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK8. |
Clone: | 3F7 |
Isotype: | IgG2a Kappa |
Gene id: | 5599 |
Gene name: | MAPK8 |
Gene alias: | JNK|JNK1|JNK1A2|JNK21B1/2|PRKM8|SAPK1 |
Gene description: | mitogen-activated protein kinase 8 |
Genbank accession: | NM_139049 |
Immunogen: | MAPK8 (NP_620637, 318 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR |
Protein accession: | NP_620637 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MAPK8 expression in transfected 293T cell line by MAPK8 monoclonal antibody (M10), clone 3F7. Lane 1: MAPK8 transfected lysate(48.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |