MAPK8 monoclonal antibody (M06), clone 4A11 View larger

MAPK8 monoclonal antibody (M06), clone 4A11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPK8 monoclonal antibody (M06), clone 4A11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr,IP

More info about MAPK8 monoclonal antibody (M06), clone 4A11

Brand: Abnova
Reference: H00005599-M06
Product name: MAPK8 monoclonal antibody (M06), clone 4A11
Product description: Mouse monoclonal antibody raised against a partial recombinant MAPK8.
Clone: 4A11
Isotype: IgG2b Kappa
Gene id: 5599
Gene name: MAPK8
Gene alias: JNK|JNK1|JNK1A2|JNK21B1/2|PRKM8|SAPK1
Gene description: mitogen-activated protein kinase 8
Genbank accession: NM_139049
Immunogen: MAPK8 (NP_620637, 318 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAAGPLGCCR
Protein accession: NP_620637
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005599-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005599-M06-13-15-1.jpg
Application image note: Western Blot analysis of MAPK8 expression in transfected 293T cell line by MAPK8 monoclonal antibody (M06), clone 4A11.

Lane 1: MAPK8 transfected lysate(48.3 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy MAPK8 monoclonal antibody (M06), clone 4A11 now

Add to cart