MAPK6 monoclonal antibody (M02), clone 4C11 View larger

MAPK6 monoclonal antibody (M02), clone 4C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPK6 monoclonal antibody (M02), clone 4C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about MAPK6 monoclonal antibody (M02), clone 4C11

Brand: Abnova
Reference: H00005597-M02
Product name: MAPK6 monoclonal antibody (M02), clone 4C11
Product description: Mouse monoclonal antibody raised against a partial recombinant MAPK6.
Clone: 4C11
Isotype: IgG2b Kappa
Gene id: 5597
Gene name: MAPK6
Gene alias: DKFZp686F03189|ERK3|HsT17250|PRKM6|p97MAPK
Gene description: mitogen-activated protein kinase 6
Genbank accession: BC035492
Immunogen: MAPK6 (AAH35492, 612 a.a. ~ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHLN
Protein accession: AAH35492
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005597-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00005597-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MAPK6 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAPK6 monoclonal antibody (M02), clone 4C11 now

Add to cart