Brand: | Abnova |
Reference: | H00005595-M01 |
Product name: | MAPK3 monoclonal antibody (M01), clone 3C9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK3. |
Clone: | 3C9 |
Isotype: | IgG2a Kappa |
Gene id: | 5595 |
Gene name: | MAPK3 |
Gene alias: | ERK1|HS44KDAP|HUMKER1A|MGC20180|P44ERK1|P44MAPK|PRKM3 |
Gene description: | mitogen-activated protein kinase 3 |
Genbank accession: | BC013992 |
Immunogen: | MAPK3 (AAH13992, 279 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP |
Protein accession: | AAH13992 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to MAPK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |