MAPK1 monoclonal antibody (M01A), clone 1D1 View larger

MAPK1 monoclonal antibody (M01A), clone 1D1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPK1 monoclonal antibody (M01A), clone 1D1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MAPK1 monoclonal antibody (M01A), clone 1D1

Brand: Abnova
Reference: H00005594-M01A
Product name: MAPK1 monoclonal antibody (M01A), clone 1D1
Product description: Mouse monoclonal antibody raised against a partial recombinant MAPK1.
Clone: 1D1
Isotype: IgG1 Kappa
Gene id: 5594
Gene name: MAPK1
Gene alias: ERK|ERK2|ERT1|MAPK2|P42MAPK|PRKM1|PRKM2|p38|p40|p41|p41mapk
Gene description: mitogen-activated protein kinase 1
Genbank accession: BC017832
Immunogen: MAPK1 (AAH17832, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Protein accession: AAH17832
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005594-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005594-M01A-1-25-1.jpg
Application image note: MAPK1 monoclonal antibody (M01A), clone 1D1 Western Blot analysis of MAPK1 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAPK1 monoclonal antibody (M01A), clone 1D1 now

Add to cart