PRKG1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005592-D01P
Product name: PRKG1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PRKG1 protein.
Gene id: 5592
Gene name: PRKG1
Gene alias: CGKI|DKFZp686K042|FLJ36117|MGC71944|PGK|PKG|PRKG1B|PRKGR1B|cGKI-BETA|cGKI-alpha
Gene description: protein kinase, cGMP-dependent, type I
Genbank accession: BC062688.1
Immunogen: PRKG1 (AAH62688.1, 1 a.a. ~ 312 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQG
Protein accession: AAH62688.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005592-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PRKG1 expression in transfected 293T cell line (H00005592-T02) by PRKG1 MaxPab polyclonal antibody.

Lane 1: PRKG1 transfected lysate(35.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRKG1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart