PRKG1 MaxPab mouse polyclonal antibody (B01) View larger

PRKG1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKG1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about PRKG1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00005592-B01
Product name: PRKG1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PRKG1 protein.
Gene id: 5592
Gene name: PRKG1
Gene alias: CGKI|DKFZp686K042|FLJ36117|MGC71944|PGK|PKG|PRKG1B|PRKGR1B|cGKI-BETA|cGKI-alpha
Gene description: protein kinase, cGMP-dependent, type I
Genbank accession: BC062688.1
Immunogen: PRKG1 (AAH62688.1, 1 a.a. ~ 312 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQG
Protein accession: AAH62688.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005592-B01-13-15-1.jpg
Application image note: Western Blot analysis of PRKG1 expression in transfected 293T cell line (H00005592-T01) by PRKG1 MaxPab polyclonal antibody.

Lane 1: PRKG1 transfected lysate(34.32 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRKG1 MaxPab mouse polyclonal antibody (B01) now

Add to cart