Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRKDC (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about PRKDC (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00005591-Q01 |
| Product name: | PRKDC (Human) Recombinant Protein (Q01) |
| Product description: | Human PRKDC partial ORF ( NP_008835, 4019 a.a. - 4128 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 5591 |
| Gene name: | PRKDC |
| Gene alias: | DNA-PKcs|DNAPK|DNPK1|HYRC|HYRC1|XRCC7|p350 |
| Gene description: | protein kinase, DNA-activated, catalytic polypeptide |
| Genbank accession: | NM_006904 |
| Immunogen sequence/protein sequence: | KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGREPWM |
| Protein accession: | NP_008835 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mutual regulation between DNA-PKcs and snail1 leads to increased genomic instability and aggressive tumor characteristics.Pyun BJ, Seo HR, Lee HJ, Jin YB, Kim EJ, Kim NH, Kim HS, Nam HW, Yook JI, Lee YS Cell Death Dis. 2013 Feb 28;4:e517. doi: 10.1038/cddis.2013.43. |