PRKCSH monoclonal antibody (M01), clone 3H7 View larger

PRKCSH monoclonal antibody (M01), clone 3H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKCSH monoclonal antibody (M01), clone 3H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about PRKCSH monoclonal antibody (M01), clone 3H7

Brand: Abnova
Reference: H00005589-M01
Product name: PRKCSH monoclonal antibody (M01), clone 3H7
Product description: Mouse monoclonal antibody raised against a partial recombinant PRKCSH.
Clone: 3H7
Isotype: IgG2a Kappa
Gene id: 5589
Gene name: PRKCSH
Gene alias: AGE-R2|G19P1|PCLD|PLD1
Gene description: protein kinase C substrate 80K-H
Genbank accession: BC013586
Immunogen: PRKCSH (AAH13586, 268 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ISFDFGPNGEFAYLYSQCYELTTNEYVYRLCPFKLVSQKPKLGGSPTSLGTWGSWIGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGKETMVTSTTEPSRCEYLMELM
Protein accession: AAH13586
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005589-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged PRKCSH is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PRKCSH monoclonal antibody (M01), clone 3H7 now

Add to cart