Brand: | Abnova |
Reference: | H00005588-A01 |
Product name: | PRKCQ polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PRKCQ. |
Gene id: | 5588 |
Gene name: | PRKCQ |
Gene alias: | MGC126514|MGC141919|PRKCT|nPKC-theta |
Gene description: | protein kinase C, theta |
Genbank accession: | NM_006257 |
Immunogen: | PRKCQ (NP_006248, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNN |
Protein accession: | NP_006248 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PRKCQ polyclonal antibody (A01), Lot # 051003JCO1 Western Blot analysis of PRKCQ expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |