Brand: | Abnova |
Reference: | H00005586-M01 |
Product name: | PKN2 monoclonal antibody (M01), clone 3A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PKN2. |
Clone: | 3A7 |
Isotype: | IgG1 kappa |
Gene id: | 5586 |
Gene name: | PKN2 |
Gene alias: | MGC150606|MGC71074|PAK2|PRK2|PRKCL2|PRO2042|Pak-2 |
Gene description: | protein kinase N2 |
Genbank accession: | NM_006256 |
Immunogen: | PKN2 (NP_006247, 580 a.a. ~ 679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNT |
Protein accession: | NP_006247 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PKN2 is approximately 0.1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |