Brand: | Abnova |
Reference: | H00005584-M02 |
Product name: | PRKCI monoclonal antibody (M02), clone 3A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKCI. |
Clone: | 3A7 |
Isotype: | IgG1 Kappa |
Gene id: | 5584 |
Gene name: | PRKCI |
Gene alias: | DXS1179E|MGC26534|PKCI|nPKC-iota |
Gene description: | protein kinase C, iota |
Genbank accession: | BC022016 |
Immunogen: | PRKCI (AAH22016, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCV |
Protein accession: | AAH22016 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PRKCI monoclonal antibody (M02), clone 3A7 Western Blot analysis of PRKCI expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |