PRKCD monoclonal antibody (M04), clone 2F3 View larger

PRKCD monoclonal antibody (M04), clone 2F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKCD monoclonal antibody (M04), clone 2F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PRKCD monoclonal antibody (M04), clone 2F3

Brand: Abnova
Reference: H00005580-M04
Product name: PRKCD monoclonal antibody (M04), clone 2F3
Product description: Mouse monoclonal antibody raised against a partial recombinant PRKCD.
Clone: 2F3
Isotype: IgG2a Kappa
Gene id: 5580
Gene name: PRKCD
Gene alias: MAY1|MGC49908|PKCD|nPKC-delta
Gene description: protein kinase C, delta
Genbank accession: NM_006254
Immunogen: PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Protein accession: NP_006245
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005580-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005580-M04-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged PRKCD is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRKCD monoclonal antibody (M04), clone 2F3 now

Add to cart