PRKCD monoclonal antibody (M02), clone 6A2 View larger

PRKCD monoclonal antibody (M02), clone 6A2

H00005580-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKCD monoclonal antibody (M02), clone 6A2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about PRKCD monoclonal antibody (M02), clone 6A2

Brand: Abnova
Reference: H00005580-M02
Product name: PRKCD monoclonal antibody (M02), clone 6A2
Product description: Mouse monoclonal antibody raised against a partial recombinant PRKCD.
Clone: 6A2
Isotype: IgG2a Kappa
Gene id: 5580
Gene name: PRKCD
Gene alias: MAY1|MGC49908|PKCD|nPKC-delta
Gene description: protein kinase C, delta
Genbank accession: NM_006254
Immunogen: PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED
Protein accession: NP_006245
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005580-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005580-M02-42-R01V-1.jpg
Application image note: Western blot analysis of PRKCD over-expressed 293 cell line, cotransfected with PRKCD Validated Chimera RNAi ( Cat # H00005580-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PRKCD monoclonal antibody (M02) clone 6A2 (Cat # H00005580-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy PRKCD monoclonal antibody (M02), clone 6A2 now

Add to cart