PRKCA monoclonal antibody (M01A), clone 2F11 View larger

PRKCA monoclonal antibody (M01A), clone 2F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKCA monoclonal antibody (M01A), clone 2F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PRKCA monoclonal antibody (M01A), clone 2F11

Brand: Abnova
Reference: H00005578-M01A
Product name: PRKCA monoclonal antibody (M01A), clone 2F11
Product description: Mouse monoclonal antibody raised against a partial recombinant PRKCA.
Clone: 2F11
Isotype: IgG1 Kappa
Gene id: 5578
Gene name: PRKCA
Gene alias: AAG6|MGC129900|MGC129901|PKC-alpha|PKCA|PRKACA
Gene description: protein kinase C, alpha
Genbank accession: NM_002737
Immunogen: PRKCA (NP_002728, 563 a.a. ~ 672 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
Protein accession: NP_002728
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005578-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005578-M01A-1-1-1.jpg
Application image note: PRKCA monoclonal antibody (M01A), clone 2F11 Western Blot analysis of PRKCA expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRKCA monoclonal antibody (M01A), clone 2F11 now

Add to cart