Brand: | Abnova |
Reference: | H00005576-M01 |
Product name: | PRKAR2A monoclonal antibody (M01), clone 6A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKAR2A. |
Clone: | 6A9 |
Isotype: | IgG1 Kappa |
Gene id: | 5576 |
Gene name: | PRKAR2A |
Gene alias: | MGC3606|PKR2|PRKAR2 |
Gene description: | protein kinase, cAMP-dependent, regulatory, type II, alpha |
Genbank accession: | BC002763 |
Immunogen: | PRKAR2A (AAH02763, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETY |
Protein accession: | AAH02763 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PRKAR2A monoclonal antibody (M01), clone 6A9 Western Blot analysis of PRKAR2A expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |