PRKAR2A monoclonal antibody (M01), clone 6A9 View larger

PRKAR2A monoclonal antibody (M01), clone 6A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKAR2A monoclonal antibody (M01), clone 6A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about PRKAR2A monoclonal antibody (M01), clone 6A9

Brand: Abnova
Reference: H00005576-M01
Product name: PRKAR2A monoclonal antibody (M01), clone 6A9
Product description: Mouse monoclonal antibody raised against a partial recombinant PRKAR2A.
Clone: 6A9
Isotype: IgG1 Kappa
Gene id: 5576
Gene name: PRKAR2A
Gene alias: MGC3606|PKR2|PRKAR2
Gene description: protein kinase, cAMP-dependent, regulatory, type II, alpha
Genbank accession: BC002763
Immunogen: PRKAR2A (AAH02763, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETY
Protein accession: AAH02763
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005576-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005576-M01-1-1-1.jpg
Application image note: PRKAR2A monoclonal antibody (M01), clone 6A9 Western Blot analysis of PRKAR2A expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRKAR2A monoclonal antibody (M01), clone 6A9 now

Add to cart