PRKACA monoclonal antibody (M04A), clone X2 View larger

PRKACA monoclonal antibody (M04A), clone X2

H00005566-M04A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKACA monoclonal antibody (M04A), clone X2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PRKACA monoclonal antibody (M04A), clone X2

Brand: Abnova
Reference: H00005566-M04A
Product name: PRKACA monoclonal antibody (M04A), clone X2
Product description: Mouse monoclonal antibody raised against a partial recombinant PRKACA.
Clone: X2
Isotype: IgG2a Kappa
Gene id: 5566
Gene name: PRKACA
Gene alias: MGC102831|MGC48865|PKACA
Gene description: protein kinase, cAMP-dependent, catalytic, alpha
Genbank accession: BC039846
Immunogen: PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
Protein accession: AAH39846
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005566-M04A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.94 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRKACA monoclonal antibody (M04A), clone X2 now

Add to cart