Brand: | Abnova |
Reference: | H00005565-M01 |
Product name: | PRKAB2 monoclonal antibody (M01), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PRKAB2. |
Clone: | 2G9 |
Isotype: | IgG2b kappa |
Gene id: | 5565 |
Gene name: | PRKAB2 |
Gene alias: | MGC61468 |
Gene description: | protein kinase, AMP-activated, beta 2 non-catalytic subunit |
Genbank accession: | BC053610 |
Immunogen: | PRKAB2 (AAH53610, 1 a.a. ~ 272 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSFNNWSTKIPLIKSHNDFVAILDLPEGEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYALSIKDSVMVLSATHRYKKKYVTTLLYKPI |
Protein accession: | AAH53610 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (55.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PRKAB2 monoclonal antibody (M01), clone 2G9 Western Blot analysis of PRKAB2 expression in Hela ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |