Brand: | Abnova |
Reference: | H00005564-M07 |
Product name: | PRKAB1 monoclonal antibody (M07), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PRKAB1. |
Clone: | 1D3 |
Isotype: | IgG2b Kappa |
Gene id: | 5564 |
Gene name: | PRKAB1 |
Gene alias: | AMPK|HAMPKb|MGC17785 |
Gene description: | protein kinase, AMP-activated, beta 1 non-catalytic subunit |
Genbank accession: | BC017671 |
Immunogen: | PRKAB1 (AAH17671, 1 a.a. ~ 270 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI |
Protein accession: | AAH17671 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005564-M07-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005564-M07-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (55.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![H00005564-M07-1-27-1.jpg](http://www.abnova.com/application_image/H00005564-M07-1-27-1.jpg) |
Application image note: | PRKAB1 monoclonal antibody (M07), clone 1D3. Western Blot analysis of PRKAB1 expression in Raw 264.7 ( Cat # L024V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |