Brand: | Abnova |
Reference: | H00005562-M03 |
Product name: | PRKAA1 monoclonal antibody (M03), clone 4D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKAA1. |
Clone: | 4D8 |
Isotype: | IgG2a Kappa |
Gene id: | 5562 |
Gene name: | PRKAA1 |
Gene alias: | AMPK|AMPKa1|MGC33776|MGC57364 |
Gene description: | protein kinase, AMP-activated, alpha 1 catalytic subunit |
Genbank accession: | NM_006251 |
Immunogen: | PRKAA1 (AAH12622, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ |
Protein accession: | AAH12622 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PRKAA1 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |