PRKAA1 monoclonal antibody (M01), clone 1G4 View larger

PRKAA1 monoclonal antibody (M01), clone 1G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKAA1 monoclonal antibody (M01), clone 1G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PRKAA1 monoclonal antibody (M01), clone 1G4

Brand: Abnova
Reference: H00005562-M01
Product name: PRKAA1 monoclonal antibody (M01), clone 1G4
Product description: Mouse monoclonal antibody raised against a partial recombinant PRKAA1.
Clone: 1G4
Isotype: IgG2a Kappa
Gene id: 5562
Gene name: PRKAA1
Gene alias: AMPK|AMPKa1|MGC33776|MGC57364
Gene description: protein kinase, AMP-activated, alpha 1 catalytic subunit
Genbank accession: NM_006251
Immunogen: PRKAA1 (AAH12622, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
Protein accession: AAH12622
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005562-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005562-M01-1-12-1.jpg
Application image note: PRKAA1 monoclonal antibody (M01), clone 1G4 Western Blot analysis of PRKAA1 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRKAA1 monoclonal antibody (M01), clone 1G4 now

Add to cart