Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRH2 monoclonal antibody (M03), clone 1E6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about PRH2 monoclonal antibody (M03), clone 1E6
| Brand: | Abnova |
| Reference: | H00005555-M03 |
| Product name: | PRH2 monoclonal antibody (M03), clone 1E6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PRH2. |
| Clone: | 1E6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5555 |
| Gene name: | PRH2 |
| Gene alias: | DKFZp686B01256|DKFZp686F14256|DKFZp686I11251|DKFZp686J06255|DKFZp686L01253|DKFZp686L16244|DKFZp686M04243|DKFZp686N24248|Pr |
| Gene description: | proline-rich protein HaeIII subfamily 2 |
| Genbank accession: | NM_005042.2 |
| Immunogen: | PRH2 (NP_005033.1, 1 a.a. ~ 166 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQNDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ |
| Protein accession: | NP_005033.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.4 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PRH2 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |