Brand: | Abnova |
Reference: | H00005549-M01A |
Product name: | PRELP monoclonal antibody (M01A), clone 3H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRELP. |
Clone: | 3H1 |
Isotype: | IgM Kappa |
Gene id: | 5549 |
Gene name: | PRELP |
Gene alias: | MGC45323|MST161|MSTP161|SLRR2A |
Gene description: | proline/arginine-rich end leucine-rich repeat protein |
Genbank accession: | NM_002725 |
Immunogen: | PRELP (NP_002716.1, 281 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPP |
Protein accession: | NP_002716.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.09 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |