Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPP3R1 monoclonal antibody (M01), clone 4E1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
More info about PPP3R1 monoclonal antibody (M01), clone 4E1
| Brand: | Abnova |
| Reference: | H00005534-M01 |
| Product name: | PPP3R1 monoclonal antibody (M01), clone 4E1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PPP3R1. |
| Clone: | 4E1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5534 |
| Gene name: | PPP3R1 |
| Gene alias: | CALNB1|CNB|CNB1 |
| Gene description: | protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform |
| Genbank accession: | BC027913 |
| Immunogen: | PPP3R1 (AAH27913, 1 a.a. ~ 170 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV |
| Protein accession: | AAH27913 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to PPP3R1 on HeLa cell. [antibody concentration 25 ug/ml] |
| Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Placenta-specific miRNA (miR-512-3p) targets PPP3R1 encoding the calcineurin B regulatory subunit in BeWo cells.Kurashina R, Kikuchi K, Iwaki J, Yoshitake H, Takeshita T, Takizawa T J Obstet Gynaecol Res. 2014 Mar;40(3):650-60. doi: 10.1111/jog.12217. Epub 2013 Nov 18. |