Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPP3CA monoclonal antibody (M03), clone 2G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,IHC-P,IF,ELISA,WB-Re,WB-Tr |
More info about PPP3CA monoclonal antibody (M03), clone 2G8
| Brand: | Abnova |
| Reference: | H00005530-M03 |
| Product name: | PPP3CA monoclonal antibody (M03), clone 2G8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP3CA. |
| Clone: | 2G8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5530 |
| Gene name: | PPP3CA |
| Gene alias: | CALN|CALNA|CALNA1|CCN1|CNA1|PPP2B |
| Gene description: | protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform |
| Genbank accession: | NM_000944 |
| Immunogen: | PPP3CA (NP_000935, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAP |
| Protein accession: | NP_000935 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.98 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PPP3CA on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml] |
| Applications: | WB-Ti,IHC-P,IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | No impact of protein phosphatases on connexin 43 phosphorylation in ischemic preconditioning.Totzeck A, Boengler K, van de Sand A, Konietzka I, Gres P, Garcia-Dorado D, Heusch G, Schulz R. Am J Physiol Heart Circ Physiol. 2008 Nov;295(5):H2106-12. Epub 2008 Oct 3. |