Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPP2R5D monoclonal antibody (M21), clone 1A3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about PPP2R5D monoclonal antibody (M21), clone 1A3
| Brand: | Abnova |
| Reference: | H00005528-M21 |
| Product name: | PPP2R5D monoclonal antibody (M21), clone 1A3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP2R5D. |
| Clone: | 1A3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5528 |
| Gene name: | PPP2R5D |
| Gene alias: | B56D|MGC2134|MGC8949 |
| Gene description: | protein phosphatase 2, regulatory subunit B', delta isoform |
| Genbank accession: | NM_006245 |
| Immunogen: | PPP2R5D (NP_006236.1, 514 a.a. ~ 602 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEAL |
| Protein accession: | NP_006236.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PPP2R5D monoclonal antibody (M21), clone 1A3. Western Blot analysis of PPP2R5D expression in Jurkat(Cat # L017V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |